ECHDC2 antibody (70R-5271)

Rabbit polyclonal ECHDC2 antibody raised against the middle region of ECHDC2

Synonyms Polyclonal ECHDC2 antibody, Anti-ECHDC2 antibody, Enoyl Coenzyme A Hydratase Domain Containing 2 antibody, FLJ10948 antibody
Specificity ECHDC2 antibody was raised against the middle region of ECHDC2
Cross Reactivity Human,Rat
Applications WB
Immunogen ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR
Assay Information ECHDC2 Blocking Peptide, catalog no. 33R-9249, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Images

Western Blot analysis using ECHDC2 antibody (70R-5271)

ECHDC2 antibody (70R-5271) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ECHDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ECHDC2 antibody (70R-5271) | ECHDC2 antibody (70R-5271) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors