ECHS1 antibody (70R-2490)

Rabbit polyclonal ECHS1 antibody raised against the N terminal of ECHS1

Synonyms Polyclonal ECHS1 antibody, Anti-ECHS1 antibody, Enoyl Coenzyme A Hydratase Short Chain 1 Mitochondrial antibody, SCEH antibody
Specificity ECHS1 antibody was raised against the N terminal of ECHS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI
Assay Information ECHS1 Blocking Peptide, catalog no. 33R-3990, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Images

Western Blot analysis using ECHS1 antibody (70R-2490)

ECHS1 antibody (70R-2490) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ECHS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The protein is a member of the hydratase/isomerase superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ECHS1 antibody (70R-2490) | ECHS1 antibody (70R-2490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors