Ectodysplasin A antibody (70R-5969)

Rabbit polyclonal Ectodysplasin A antibody raised against the middle region of EDA

Synonyms Polyclonal Ectodysplasin A antibody, Anti-Ectodysplasin A antibody, EDA1 antibody, EDA antibody, ED1-A2 antibody, ED1-A1 antibody, ED1 antibody, HED antibody, XLHED antibody, XHED antibody, EDA2 antibody
Specificity Ectodysplasin A antibody was raised against the middle region of EDA
Cross Reactivity Human,Mouse
Applications WB
Immunogen Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY
Assay Information Ectodysplasin A Blocking Peptide, catalog no. 33R-3785, is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A antibody

Images

Western Blot analysis using Ectodysplasin A antibody (70R-5969)

Ectodysplasin A antibody (70R-5969) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EDA is a type II membrane protein that can be cleaved by furin to produce a secreted form. It belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ectodysplasin A antibody (70R-5969) | Ectodysplasin A antibody (70R-5969) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors