Ectodysplasin A Receptor antibody (70R-7548)

Rabbit polyclonal Ectodysplasin A Receptor antibody raised against the middle region of EDAR

Synonyms Polyclonal Ectodysplasin A Receptor antibody, Anti-Ectodysplasin A Receptor antibody, ED5 antibody, EDA1R antibody, ED3 antibody, EDAR antibody, EDA3 antibody, DL antibody, ED1R antibody, EDA-A1R antibody
Specificity Ectodysplasin A Receptor antibody was raised against the middle region of EDAR
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV
Assay Information Ectodysplasin A Receptor Blocking Peptide, catalog no. 33R-6971, is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A Receptor antibody

Images

Western Blot analysis using Ectodysplasin A Receptor antibody (70R-7548)

Ectodysplasin A Receptor antibody (70R-7548) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDAR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ectodysplasin A Receptor antibody (70R-7548) | Ectodysplasin A Receptor antibody (70R-7548) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors