EDEM1 antibody (70R-6871)

Rabbit polyclonal EDEM1 antibody raised against the N terminal of EDEM1

Synonyms Polyclonal EDEM1 antibody, Anti-EDEM1 antibody, EDEM antibody, KIAA0212 antibody, Er Degradation Enhancer Mannosidase Alpha-Like 1 antibody
Specificity EDEM1 antibody was raised against the N terminal of EDEM1
Cross Reactivity Human,Mouse
Applications WB
Immunogen EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
Assay Information EDEM1 Blocking Peptide, catalog no. 33R-5674, is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody

Images

Western Blot analysis using EDEM1 antibody (70R-6871)

EDEM1 antibody (70R-6871) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDEM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EDEM1 antibody (70R-6871) | EDEM1 antibody (70R-6871) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors