EDG8 antibody (70R-6973)

Rabbit polyclonal EDG8 antibody raised against the N terminal of EDG8

Synonyms Polyclonal EDG8 antibody, Anti-EDG8 antibody, SPPR-1 antibody, Endothelial Differentiation Sphingolipid G-Protein-Coupled Receptor 8 antibody, EDG 8 antibody, S1P5 antibody, SPPR-2 antibody, Edg-8 antibody, EDG 8, EDG-8 antibody, EDG-8, EDG8, S1PR5 antibody
Specificity EDG8 antibody was raised against the N terminal of EDG8
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
Assay Information EDG8 Blocking Peptide, catalog no. 33R-5959, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Images

Immunohistochemical staining using EDG8 antibody (70R-6973)

EDG8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDG8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using EDG8 antibody (70R-6973) | EDG8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using EDG8 antibody (70R-6973) | EDG8 antibody (70R-6973) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors