EEF2 antibody (70R-2318)

Rabbit polyclonal EEF2 antibody raised against the N terminal of EEF2

Synonyms Polyclonal EEF2 antibody, Anti-EEF2 antibody, EEF-2 antibody, EF2 antibody, Eukaryotic Translation Elongation Factor 2 antibody
Specificity EEF2 antibody was raised against the N terminal of EEF2
Cross Reactivity Human,Mouse,Rat,C.elegans,Drosophila
Applications WB
Immunogen EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND
Assay Information EEF2 Blocking Peptide, catalog no. 33R-9020, is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Images

Western Blot analysis using EEF2 antibody (70R-2318)

EEF2 antibody (70R-2318) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EEF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EEF2 antibody (70R-2318) | EEF2 antibody (70R-2318) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors