EFCAB4B antibody (70R-3774)

Rabbit polyclonal EFCAB4B antibody raised against the N terminal of EFCAB4B

Synonyms Polyclonal EFCAB4B antibody, Anti-EFCAB4B antibody, MGC4266 antibody, FLJ33805 antibody, Ef-Hand Calcium Binding Domain 4B antibody
Specificity EFCAB4B antibody was raised against the N terminal of EFCAB4B
Cross Reactivity Human
Applications WB
Immunogen EFCAB4B antibody was raised using the N terminal of EFCAB4B corresponding to a region with amino acids ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
Assay Information EFCAB4B Blocking Peptide, catalog no. 33R-1476, is also available for use as a blocking control in assays to test for specificity of this EFCAB4B antibody

Images

Western Blot analysis using EFCAB4B antibody (70R-3774)

EFCAB4B antibody (70R-3774) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFCAB4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EFCAB4B is a Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EFCAB4B antibody (70R-3774) | EFCAB4B antibody (70R-3774) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors