EFEMP2 antibody (70R-5311)

Rabbit polyclonal EFEMP2 antibody raised against the middle region of EFEMP2

Synonyms Polyclonal EFEMP2 antibody, Anti-EFEMP2 antibody, FBLN4 antibody, UPH1 antibody, MBP1 antibody, Egf-Containing Fibulin-Like Extracellular Matrix Protein 2 antibody
Specificity EFEMP2 antibody was raised against the middle region of EFEMP2
Cross Reactivity Human
Applications WB
Immunogen EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
Assay Information EFEMP2 Blocking Peptide, catalog no. 33R-9797, is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Images

Western Blot analysis using EFEMP2 antibody (70R-5311)

EFEMP2 antibody (70R-5311) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFEMP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EFEMP2 antibody (70R-5311) | EFEMP2 antibody (70R-5311) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors