EGF antibody (70R-5697)

Rabbit polyclonal EGF antibody

Synonyms Polyclonal EGF antibody, Anti-EGF antibody, URG antibody, Beta-Urogastrone antibody, Epidermal Growth Factor antibody
Cross Reactivity Human
Applications WB
Immunogen EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
Assay Information EGF Blocking Peptide, catalog no. 33R-4179, is also available for use as a blocking control in assays to test for specificity of this EGF antibody

Images

Western Blot analysis using EGF antibody (70R-5697)

EGF antibody (70R-5697) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 6 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EGF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EGF antibody (70R-5697) | EGF antibody (70R-5697) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors