EIF2B1 antibody (70R-3849)

Rabbit polyclonal EIF2B1 antibody raised against the C terminal of EIF2B1

Synonyms Polyclonal EIF2B1 antibody, Anti-EIF2B1 antibody, EIF2B antibody, MGC125868 antibody, EIF-2B antibody, EIF2B1, EIFB1 2 antibody, EIFB1-2, EIF-2Balpha antibody, EIF2BA antibody, EIFB1-2 antibody, MGC125869 antibody, EIFB1 2, Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha antibody, MGC117409 antibody
Specificity EIF2B1 antibody was raised against the C terminal of EIF2B1
Cross Reactivity Human
Applications WB
Immunogen EIF2B1 antibody was raised using the C terminal of EIF2B1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
Assay Information EIF2B1 Blocking Peptide, catalog no. 33R-1107, is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody


Western Blot analysis using EIF2B1 antibody (70R-3849)

EIF2B1 antibody (70R-3849) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF2B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF2B1 antibody (70R-3849) | EIF2B1 antibody (70R-3849) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors