EIF2B1 Blocking Peptide (33R-1107)

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2B1 antibody, catalog no. 70R-3849

Synonyms EIF2B1 control peptide, EIF2B1 antibody Blocking Peptide, Anti-EIF2B1 Blocking Peptide, Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha Blocking Peptide, EIF-2B Blocking Peptide, EIF-2Balpha Blocking Peptide, EIF2B Blocking Peptide, EIF2BA Blocking Peptide, MGC117409 Blocking Peptide, MGC125868 Blocking Peptide, MGC125869 Blocking Peptide, EIF2B1, EIFB1-2, EIFB1 2, EIFB1-2 Blocking Peptide, EIFB1 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors