EIF2B5 Blocking Peptide (33R-10336)

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2B5 antibody, catalog no. 70R-10295

Synonyms EIF2B5 control peptide, EIF2B5 antibody Blocking Peptide, Anti-EIF2B5 Blocking Peptide, eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa Blocking Peptide, CACH Blocking Peptide, CLE Blocking Peptide, EIF-2B Blocking Peptide, EIF2Bepsilon Blocking Peptide, LVWM Blocking Peptide, EIF2B5, EIFB5-2, EIFB5 2, EIFB5-2 Blocking Peptide, EIFB5 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI
Molecular Weight 79 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors