EIF2C1 antibody (70R-3471)

Rabbit polyclonal EIF2C1 antibody raised against the N terminal of EIF2C1

Synonyms Polyclonal EIF2C1 antibody, Anti-EIF2C1 antibody, GERP95 antibody, EIF2C1, EIFC1 2 antibody, AGO1 antibody, Q99 antibody, Eukaryotic Translation Initiation Factor 2C 1 antibody, DKFZp686M13167 antibody, EIFC1 2, EIFC1-2 antibody, EIF2C antibody, EIFC1-2
Specificity EIF2C1 antibody was raised against the N terminal of EIF2C1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen EIF2C1 antibody was raised using the N terminal of EIF2C1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI
Assay Information EIF2C1 Blocking Peptide, catalog no. 33R-5890, is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody


Western Blot analysis using EIF2C1 antibody (70R-3471)

EIF2C1 antibody (70R-3471) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF2C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF2C1 antibody (70R-3471) | EIF2C1 antibody (70R-3471) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors