EIF2S1 antibody (70R-1419)

Rabbit polyclonal EIF2S1 antibody raised against the C terminal of EIF2S1

Synonyms Polyclonal EIF2S1 antibody, Anti-EIF2S1 antibody, EIFS1-2, EIF2S1, EIF-2alpha antibody, EIF-2 antibody, EIF-2A antibody, EIF2A antibody, EIFS1-2 antibody, EIF2 antibody, EIFS1 2, Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha 35Kda antibody, EIFS1 2 antibody
Specificity EIF2S1 antibody was raised against the C terminal of EIF2S1
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen EIF2S1 antibody was raised using the C terminal of EIF2S1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED
Assay Information EIF2S1 Blocking Peptide, catalog no. 33R-7946, is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Images

Western Blot analysis using EIF2S1 antibody (70R-1419)

EIF2S1 antibody (70R-1419) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF2S1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kDa), beta (38 kDa), and gamma (52 kDa). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF2S1 antibody (70R-1419) | EIF2S1 antibody (70R-1419) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using EIF2S1 antibody (70R-1419) | EIF2S1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors