EIF2S2 antibody (70R-4905)

Rabbit polyclonal EIF2S2 antibody raised against the N terminal of EIF2S2

Synonyms Polyclonal EIF2S2 antibody, Anti-EIF2S2 antibody, EIF2 antibody, EIFS-2 antibody, EIFS 2, EIF2beta antibody, DKFZp686L18198 antibody, Eukaryotic Translation Initiation Factor 2 Subunit 2 Beta 38Kda antibody, EIF2B antibody, EIFS 2 antibody, EIF2S2, MGC8508 antibody, EIFS-2
Specificity EIF2S2 antibody was raised against the N terminal of EIF2S2
Cross Reactivity Human
Applications WB
Immunogen EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK
Assay Information EIF2S2 Blocking Peptide, catalog no. 33R-9251, is also available for use as a blocking control in assays to test for specificity of this EIF2S2 antibody

Images

Western Blot analysis using EIF2S2 antibody (70R-4905)

EIF2S2 antibody (70R-4905) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF2S2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF2S2 antibody (70R-4905) | EIF2S2 antibody (70R-4905) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors