EIF3E antibody (70R-3591)

Rabbit polyclonal EIF3E antibody raised against the N terminal of EIF3E

Synonyms Polyclonal EIF3E antibody, Anti-EIF3E antibody, EIFE-3 antibody, EIFE-3, EIF3E, EIFE 3, INT6 antibody, eIF3-p46 antibody, EIF3S6 antibody, EIF3-P48 antibody, Eukaryotic Translation Initiation Factor 3 Subunit E antibody, EIFE 3 antibody
Specificity EIF3E antibody was raised against the N terminal of EIF3E
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF3E antibody was raised using the N terminal of EIF3E corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
Assay Information EIF3E Blocking Peptide, catalog no. 33R-2557, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Western blot analysis using EIF3E antibody (70R-3591)

Recommended EIF3E Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF3E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using EIF3E antibody (70R-3591) | Recommended EIF3E Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using EIF3E antibody (70R-3591) | Kidney
  • Western blot analysis using EIF3E antibody (70R-3591) | EIF3E antibody validated by WB using B8 mouse cells and HEK293 human cells at 1: 1,000.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors