EIF3F Blocking Peptide (33R-10424)

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3F antibody, catalog no. 70R-10401

Synonyms EIF3F control peptide, EIF3F antibody Blocking Peptide, Anti-EIF3F Blocking Peptide, eukaryotic translation initiation factor 3, subunit F Blocking Peptide, EIF3S5 Blocking Peptide, eIF3-p47 Blocking Peptide, EIF3F, EIFF-3, EIFF 3, EIFF-3 Blocking Peptide, EIFF 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEV
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3F is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors