EIF3G antibody (70R-4993)

Rabbit polyclonal EIF3G antibody raised against the middle region of EIF3G

Synonyms Polyclonal EIF3G antibody, Anti-EIF3G antibody, Eukaryotic Translation Initiation Factor 3 Subunit G antibody, eIF3-delta antibody, EIF3-P42 antibody, EIFG-3 antibody, EIFG 3, EIF3G, EIF3S4 antibody, eIF3-p44 antibody, EIFG 3 antibody, EIFG-3
Specificity EIF3G antibody was raised against the middle region of EIF3G
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF3G antibody was raised using the middle region of EIF3G corresponding to a region with amino acids LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
Assay Information EIF3G Blocking Peptide, catalog no. 33R-5350, is also available for use as a blocking control in assays to test for specificity of this EIF3G antibody

Images

Western Blot analysis using EIF3G antibody (70R-4993)

EIF3G antibody (70R-4993) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF3G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF3G antibody (70R-4993) | EIF3G antibody (70R-4993) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors