EIF3S4 antibody (70R-1402)

Rabbit polyclonal EIF3S4 antibody raised against the N terminal of EIF3S4

Synonyms Polyclonal EIF3S4 antibody, Anti-EIF3S4 antibody, Eukaryotic Translation Initiation Factor 3 Subunit 4 Delta 44Kda antibody, EIFS4 3 antibody, EIFS4 3, EIFS4-3 antibody, EIF3S4, EIFS4-3
Specificity EIF3S4 antibody was raised against the N terminal of EIF3S4
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen EIF3S4 antibody was raised using the N terminal of EIF3S4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
Assay Information EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody

Images

Western Blot analysis using EIF3S4 antibody (70R-1402)

EIF3S4 antibody (70R-1402) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF3S4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF3S4 antibody (70R-1402) | EIF3S4 antibody (70R-1402) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors