EIF3S9 antibody (70R-4767)

Rabbit polyclonal EIF3S9 antibody raised against the C terminal of EIF3S9

Synonyms Polyclonal EIF3S9 antibody, Anti-EIF3S9 antibody, EIFS9 3, EIFS9 3 antibody, EIFS9-3, EIF3S9, Eukaryotic Translation Initiation Factor 3 Subunit 9 Eta 116Kda antibody, EIFS9-3 antibody
Specificity EIF3S9 antibody was raised against the C terminal of EIF3S9
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen EIF3S9 antibody was raised using the C terminal of EIF3S9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
Assay Information EIF3S9 Blocking Peptide, catalog no. 33R-10226, is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody


Western Blot analysis using EIF3S9 antibody (70R-4767)

EIF3S9 antibody (70R-4767) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF3S9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF3S9 antibody (70R-4767) | EIF3S9 antibody (70R-4767) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors