EIF4A1 antibody (70R-4514)

Rabbit polyclonal EIF4A1 antibody raised against the middle region of EIF4A1

Synonyms Polyclonal EIF4A1 antibody, Anti-EIF4A1 antibody, DDX2A antibody, EIF4A1, EIFA1 4 antibody, EIF-4A antibody, EIFA1-4 antibody, EIFA1-4, Eukaryotic Translation Initiation Factor 4A1 antibody, EIF4A antibody, EIFA1 4
Specificity EIF4A1 antibody was raised against the middle region of EIF4A1
Cross Reactivity Human
Applications WB
Immunogen EIF4A1 antibody was raised using the middle region of EIF4A1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
Assay Information EIF4A1 Blocking Peptide, catalog no. 33R-9207, is also available for use as a blocking control in assays to test for specificity of this EIF4A1 antibody

Images

Western Blot analysis using EIF4A1 antibody (70R-4514)

EIF4A1 antibody (70R-4514) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF4A1 antibody (70R-4514) | EIF4A1 antibody (70R-4514) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors