EIF4E antibody (70R-4682)

Rabbit polyclonal EIF4E antibody raised against the C terminal of EIF4E

Synonyms Polyclonal EIF4E antibody, Anti-EIF4E antibody, EIFE 4 antibody, EIFE-4 antibody, CBP antibody, EIFE 4, EIF4E1 antibody, Eukaryotic Translation Initiation Factor 4E antibody, EIF4F antibody, EIF4EL1 antibody, EIF4E, EIFE-4, MGC111573 antibody
Specificity EIF4E antibody was raised against the C terminal of EIF4E
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Assay Information EIF4E Blocking Peptide, catalog no. 33R-9028, is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody


Western Blot analysis using EIF4E antibody (70R-4682)

EIF4E antibody (70R-4682) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4E antibody (70R-4682) | EIF4E antibody (70R-4682) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors