EIF4E3 antibody (70R-5011)

Rabbit polyclonal EIF4E3 antibody raised against the middle region of EIF4E3

Synonyms Polyclonal EIF4E3 antibody, Anti-EIF4E3 antibody, EIF-4E3, EIF4E3, EIF 4E3 antibody, Eukaryotic Translation Initiation Factor 4E Family Member 3 antibody, MGC86971 antibody, EIF-4E3 antibody, EIF 4E3, MGC39820 antibody
Specificity EIF4E3 antibody was raised against the middle region of EIF4E3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF4E3 antibody was raised using the middle region of EIF4E3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
Assay Information EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody


Western Blot analysis using EIF4E3 antibody (70R-5011)

EIF4E3 antibody (70R-5011) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4E3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4E3 antibody (70R-5011) | EIF4E3 antibody (70R-5011) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors