EIF4ENIF1 antibody (70R-3586)

Rabbit polyclonal EIF4ENIF1 antibody raised against the N terminal of EIF4ENIF1

Synonyms Polyclonal EIF4ENIF1 antibody, Anti-EIF4ENIF1 antibody, EIFENIF1-4, EIF4ENIF1, EIFENIF1 4 antibody, Clast4 antibody, EIFENIF1 4, FLJ21601 antibody, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 antibody, 4E-T antibody, EIFENIF1-4 antibody, FLJ26551 antibody
Specificity EIF4ENIF1 antibody was raised against the N terminal of EIF4ENIF1
Cross Reactivity Human
Applications WB
Immunogen EIF4ENIF1 antibody was raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI
Assay Information EIF4ENIF1 Blocking Peptide, catalog no. 33R-9031, is also available for use as a blocking control in assays to test for specificity of this EIF4ENIF1 antibody

Images

Western Blot analysis using EIF4ENIF1 antibody (70R-3586)

EIF4ENIF1 antibody (70R-3586) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4ENIF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF4ENIF1 antibody (70R-3586) | EIF4ENIF1 antibody (70R-3586) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors