EIF4G1 antibody (70R-4875)

Rabbit polyclonal EIF4G1 antibody raised against the middle region of EIF4G1

Synonyms Polyclonal EIF4G1 antibody, Anti-EIF4G1 antibody, p220 antibody, EIF4G antibody, EIF4F antibody, DKFZp686A1451 antibody, EIF4G1, Eukaryotic Translation Initiation Factor 4 Gamma 1 antibody, EIFG1 4 antibody, EIFG1-4, EIFG1-4 antibody, EIFG1 4
Specificity EIF4G1 antibody was raised against the middle region of EIF4G1
Cross Reactivity Human
Applications WB
Immunogen EIF4G1 antibody was raised using the middle region of EIF4G1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ
Assay Information EIF4G1 Blocking Peptide, catalog no. 33R-6989, is also available for use as a blocking control in assays to test for specificity of this EIF4G1 antibody


Western Blot analysis using EIF4G1 antibody (70R-4875)

EIF4G1 antibody (70R-4875) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 175 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4G1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4G1 antibody (70R-4875) | EIF4G1 antibody (70R-4875) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors