EIF4G2 antibody (70R-4902)

Rabbit polyclonal EIF4G2 antibody raised against the C terminal of EIF4G2

Synonyms Polyclonal EIF4G2 antibody, Anti-EIF4G2 antibody, EIFG2 4 antibody, EIF4G2, EIFG2-4 antibody, EIFG2-4, Eukaryotic Translation Initiation Factor 4 Gamma 2 antibody, EIFG2 4
Specificity EIF4G2 antibody was raised against the C terminal of EIF4G2
Cross Reactivity Human,Dog
Applications WB
Immunogen EIF4G2 antibody was raised using the C terminal of EIF4G2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
Assay Information EIF4G2 Blocking Peptide, catalog no. 33R-4390, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody


Western Blot analysis using EIF4G2 antibody (70R-4902)

EIF4G2 antibody (70R-4902) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4G2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4G2 antibody (70R-4902) | EIF4G2 antibody (70R-4902) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors