EIF5 antibody (70R-3190)

Rabbit polyclonal EIF5 antibody raised against the N terminal of EIF5

Synonyms Polyclonal EIF5 antibody, Anti-EIF5 antibody, Eukaryotic Translation Initiation Factor 5 antibody, EIF-5, EIF 5 antibody, EIF5, EIF 5, EIF-5 antibody, EIF-5A antibody
Specificity EIF5 antibody was raised against the N terminal of EIF5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT
Assay Information EIF5 Blocking Peptide, catalog no. 33R-8921, is also available for use as a blocking control in assays to test for specificity of this EIF5 antibody

Images

Western Blot analysis using EIF5 antibody (70R-3190)

EIF5 antibody (70R-3190) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF5 antibody (70R-3190) | EIF5 antibody (70R-3190) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors