ELFN2 antibody (70R-6921)

Rabbit polyclonal ELFN2 antibody raised against the N terminal of ELFN2

Synonyms Polyclonal ELFN2 antibody, Anti-ELFN2 antibody, Extracellular Leucine-Rich Repeat And Fibronectin Type Iii Domain Containing 2 antibody, KIAA1904 antibody, LRRC62 antibody, dJ63G5.3 antibody
Specificity ELFN2 antibody was raised against the N terminal of ELFN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH
Assay Information ELFN2 Blocking Peptide, catalog no. 33R-7422, is also available for use as a blocking control in assays to test for specificity of this ELFN2 antibody

Images

Western Blot analysis using ELFN2 antibody (70R-6921)

ELFN2 antibody (70R-6921) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELFN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELFN2 antibody (70R-6921) | ELFN2 antibody (70R-6921) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors