ELMO3 antibody (70R-6018)

Rabbit polyclonal ELMO3 antibody raised against the middle region of ELMO3

Synonyms Polyclonal ELMO3 antibody, Anti-ELMO3 antibody, CED12 antibody, ELMO-3 antibody, Engulfment And Cell Motility 3 antibody, CED-12 antibody, FLJ13824 antibody
Specificity ELMO3 antibody was raised against the middle region of ELMO3
Cross Reactivity Human,Mouse
Applications WB
Immunogen ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED
Assay Information ELMO3 Blocking Peptide, catalog no. 33R-8001, is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody

Images

Western Blot analysis using ELMO3 antibody (70R-6018)

ELMO3 antibody (70R-6018) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELMO3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELMO3 antibody (70R-6018) | ELMO3 antibody (70R-6018) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors