ELMOD2 antibody (70R-6024)

Rabbit polyclonal ELMOD2 antibody raised against the N terminal of ELMOD2

Synonyms Polyclonal ELMOD2 antibody, Anti-ELMOD2 antibody, 9830169G11Rik antibody, MGC10084 antibody, Elmo/Ced-12 Domain Containing 2 antibody
Specificity ELMOD2 antibody was raised against the N terminal of ELMOD2
Cross Reactivity Human, Mouse
Applications WB
Immunogen ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN
Assay Information ELMOD2 Blocking Peptide, catalog no. 33R-2873, is also available for use as a blocking control in assays to test for specificity of this ELMOD2 antibody


Western Blot analysis using ELMOD2 antibody (70R-6024)

ELMOD2 antibody (70R-6024) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELMOD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELMOD2 is an engulfment and motility (ELMO) domain-containing protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ELMOD2 antibody (70R-6024) | ELMOD2 antibody (70R-6024) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors