ELOVL5 antibody (70R-6450)

Rabbit polyclonal ELOVL5 antibody

Synonyms Polyclonal ELOVL5 antibody, Anti-ELOVL5 antibody, Elovl Family Member 5 Elongation Of Long Chain Fatty Acids antibody, HELO1 antibody, RP3-483K16.1 antibody, Fen1/Elo2 Sur4/Elo3-Like Yeast antibody, dJ483K16.1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
Assay Information ELOVL5 Blocking Peptide, catalog no. 33R-2451, is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Images

Western Blot analysis using ELOVL5 antibody (70R-6450)

ELOVL5 antibody (70R-6450) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELOVL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELOVL5 antibody (70R-6450) | ELOVL5 antibody (70R-6450) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors