ELOVL7 antibody (70R-1788)

Rabbit polyclonal ELOVL7 antibody

Synonyms Polyclonal ELOVL7 antibody, Anti-ELOVL7 antibody, Elovl Family Member 7 Elongation Of Long Chain Fatty Acids antibody, FLJ23563 antibody
Cross Reactivity Human
Applications WB
Immunogen ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
Assay Information ELOVL7 Blocking Peptide, catalog no. 33R-5651, is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Images

Western Blot analysis using ELOVL7 antibody (70R-1788)

ELOVL7 antibody (70R-1788) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ELOVL7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELOVL7 antibody (70R-1788) | ELOVL7 antibody (70R-1788) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors