ELP2 antibody (70R-3178)

Rabbit polyclonal ELP2 antibody

Synonyms Polyclonal ELP2 antibody, Anti-ELP2 antibody, ELP 2 antibody, ELP2, ELP-2, Elongation Protein 2 Homolog antibody, FLJ10879 antibody, SHINC-2 antibody, StIP antibody, ELP-2 antibody, STATIP1 antibody, ELP 2
Cross Reactivity Human
Applications WB
Immunogen ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT
Assay Information ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody

Images

Western Blot analysis using ELP2 antibody (70R-3178)

ELP2 antibody (70R-3178) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELP2 antibody (70R-3178) | ELP2 antibody (70R-3178) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors