EMID1 antibody (70R-7323)

Rabbit polyclonal EMID1 antibody raised against the C terminal of EMID1

Synonyms Polyclonal EMID1 antibody, Anti-EMID1 antibody, EMID1, MGC50657 antibody, Emi Domain Containing 1 antibody, EMID 1, EMID 1 antibody, EMI5 antibody, EMU1 antibody, EMID-1 antibody, EMID-1, hEmu1 antibody
Specificity EMID1 antibody was raised against the C terminal of EMID1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
Assay Information EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody

Images

Western Blot analysis using EMID1 antibody (70R-7323)

EMID1 antibody (70R-7323) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EMID1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EMID1 antibody (70R-7323) | EMID1 antibody (70R-7323) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors