EMID2 antibody (70R-7529)

Rabbit polyclonal EMID2 antibody raised against the C terminal of EMID2

Synonyms Polyclonal EMID2 antibody, Anti-EMID2 antibody, EMID-2 antibody, EMID2, MGC129848 antibody, EMI6 antibody, Emi Domain Containing 2 antibody, EMID 2, EMID 2 antibody, EMU2 antibody, hEmu2 antibody, EMID-2, COL26A1 antibody
Specificity EMID2 antibody was raised against the C terminal of EMID2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
Assay Information EMID2 Blocking Peptide, catalog no. 33R-3653, is also available for use as a blocking control in assays to test for specificity of this EMID2 antibody

Images

Western Blot analysis using EMID2 antibody (70R-7529)

EMID2 antibody (70R-7529) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EMID2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EMID2 antibody (70R-7529) | EMID2 antibody (70R-7529) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors