EML1 antibody (70R-3550)

Rabbit polyclonal EML1 antibody raised against the C terminal of EML1

Synonyms Polyclonal EML1 antibody, Anti-EML1 antibody, FLJ45033 antibody, EML1, HuEMAP antibody, EMAPL antibody, EML 1 antibody, ELP79 antibody, Echinoderm Microtubule Associated Protein Like 1 antibody, EML 1, EML-1 antibody, EML-1, EMAP antibody
Specificity EML1 antibody was raised against the C terminal of EML1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Assay Information EML1 Blocking Peptide, catalog no. 33R-10195, is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Images

Western Blot analysis using EML1 antibody (70R-3550)

EML1 antibody (70R-3550) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EML1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EML1 antibody (70R-3550) | EML1 antibody (70R-3550) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors