EML3 antibody (70R-4256)

Rabbit polyclonal EML3 antibody raised against the N terminal of EML3

Synonyms Polyclonal EML3 antibody, Anti-EML3 antibody, EML 3, FLJ35827 antibody, Echinoderm Microtubule Associated Protein Like 3 antibody, EML3, EML-3, ELP95 antibody, EML 3 antibody, EML-3 antibody, MGC111422 antibody
Specificity EML3 antibody was raised against the N terminal of EML3
Cross Reactivity Human,Mouse
Applications WB
Immunogen EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI
Assay Information EML3 Blocking Peptide, catalog no. 33R-5198, is also available for use as a blocking control in assays to test for specificity of this EML3 antibody


Western Blot analysis using EML3 antibody (70R-4256)

EML3 antibody (70R-4256) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EML3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EML3 antibody (70R-4256) | EML3 antibody (70R-4256) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors