ENOPH1 antibody (70R-3177)

Rabbit polyclonal ENOPH1 antibody raised against the N terminal of ENOPH1

Synonyms Polyclonal ENOPH1 antibody, Anti-ENOPH1 antibody, Enolase-Phosphatase 1 antibody, DKFZp586M0524 antibody, E1 antibody, FLJ12594 antibody, MASA antibody, MST145 antibody
Specificity ENOPH1 antibody was raised against the N terminal of ENOPH1
Cross Reactivity Human
Applications WB
Immunogen ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD
Assay Information ENOPH1 Blocking Peptide, catalog no. 33R-3937, is also available for use as a blocking control in assays to test for specificity of this ENOPH1 antibody


Western Blot analysis using ENOPH1 antibody (70R-3177)

ENOPH1 antibody (70R-3177) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENOPH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ENOPH1 antibody (70R-3177) | ENOPH1 antibody (70R-3177) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors