ENOSF1 antibody (70R-3354)

Rabbit polyclonal ENOSF1 antibody raised against the N terminal of ENOSF1

Synonyms Polyclonal ENOSF1 antibody, Anti-ENOSF1 antibody, TYMSAS antibody, HSRTSBETA antibody, RTS beta antibody, RTS alpha antibody, Enolase Superfamily Member 1 antibody, RTS antibody
Specificity ENOSF1 antibody was raised against the N terminal of ENOSF1
Cross Reactivity Human
Applications WB
Immunogen ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK
Assay Information ENOSF1 Blocking Peptide, catalog no. 33R-6601, is also available for use as a blocking control in assays to test for specificity of this ENOSF1 antibody


Western Blot analysis using ENOSF1 antibody (70R-3354)

ENOSF1 antibody (70R-3354) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENOSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ENOSF1 antibody (70R-3354) | ENOSF1 antibody (70R-3354) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors