ENPP2 antibody (70R-6767)

Rabbit polyclonal ENPP2 antibody raised against the N terminal of ENPP2

Synonyms Polyclonal ENPP2 antibody, Anti-ENPP2 antibody, PDNP2 antibody, FLJ26803 antibody, ATX antibody, Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 antibody, NPP2 antibody, PD-IALPHA antibody, LysoPLD antibody, ATX-X antibody
Specificity ENPP2 antibody was raised against the N terminal of ENPP2
Cross Reactivity Human
Applications WB
Immunogen ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
Assay Information ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody

Images

Western Blot analysis using ENPP2 antibody (70R-6767)

ENPP2 antibody (70R-6767) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENPP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ENPP2 antibody (70R-6767) | ENPP2 antibody (70R-6767) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors