ENSA antibody (70R-4510)

Rabbit polyclonal ENSA antibody raised against the N terminal of ENSA

Synonyms Polyclonal ENSA antibody, Anti-ENSA antibody, MGC4319 antibody, MGC78563 antibody, MGC8394 antibody, Endosulfine Alpha antibody
Specificity ENSA antibody was raised against the N terminal of ENSA
Cross Reactivity Human
Applications WB
Immunogen ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL
Assay Information ENSA Blocking Peptide, catalog no. 33R-5662, is also available for use as a blocking control in assays to test for specificity of this ENSA antibody

Images

Western Blot analysis using ENSA antibody (70R-4510)

ENSA antibody (70R-4510) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENSA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ENSA antibody (70R-4510) | ENSA antibody (70R-4510) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors