ENTPD7 antibody (70R-6301)

Rabbit polyclonal ENTPD7 antibody raised against the C terminal of ENTPD7

Synonyms Polyclonal ENTPD7 antibody, Anti-ENTPD7 antibody, RP11-483F11.1 antibody, ENTHD 7 antibody, Ectonucleoside Triphosphate Diphosphohydrolase 7 antibody, MGC141913 antibody, ENTHD 7, ENTHD7, ENTHD-7 antibody, ENTHD-7, FLJ30978 antibody, LALP1 antibody
Specificity ENTPD7 antibody was raised against the C terminal of ENTPD7
Cross Reactivity Human
Applications WB
Immunogen ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL
Assay Information ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody

Images

Western Blot analysis using ENTPD7 antibody (70R-6301)

ENTPD7 antibody (70R-6301) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENTPD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ENTPD7 antibody (70R-6301) | ENTPD7 antibody (70R-6301) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors