ENTPD8 antibody (70R-6382)

Rabbit polyclonal ENTPD8 antibody raised against the N terminal of ENTPD8

Synonyms Polyclonal ENTPD8 antibody, Anti-ENTPD8 antibody, ENTHD-8, ENTHD 8, NTPDase-8 antibody, ENTHD 8 antibody, ENTHD-8 antibody, ENTHD8, GLSR2492 antibody, UNQ2492 antibody, Ectonucleoside Triphosphate Diphosphohydrolase 8 antibody
Specificity ENTPD8 antibody was raised against the N terminal of ENTPD8
Cross Reactivity Human
Applications WB
Immunogen ENTPD8 antibody was raised using the N terminal of ENTPD8 corresponding to a region with amino acids IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG
Assay Information ENTPD8 Blocking Peptide, catalog no. 33R-4087, is also available for use as a blocking control in assays to test for specificity of this ENTPD8 antibody

Images

Western Blot analysis using ENTPD8 antibody (70R-6382)

ENTPD8 antibody (70R-6382) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENTPD8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ENTPD8 antibody (70R-6382) | ENTPD8 antibody (70R-6382) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors