EPB41L2 antibody (70R-4218)

Rabbit polyclonal EPB41L2 antibody raised against the middle region of EPB41L2

Synonyms Polyclonal EPB41L2 antibody, Anti-EPB41L2 antibody, EPB 41 antibody, Erythrocyte Membrane Protein Band 4.1-Like 2 antibody, 4.1-G antibody, DKFZp781D1972 antibody, EPB41, EPB 41, DKFZp781H1755 antibody, EPB-41 antibody, EPB-41, RP3-324N14.1 antibody
Specificity EPB41L2 antibody was raised against the middle region of EPB41L2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EPB41L2 antibody was raised using the middle region of EPB41L2 corresponding to a region with amino acids AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST
Assay Information EPB41L2 Blocking Peptide, catalog no. 33R-1309, is also available for use as a blocking control in assays to test for specificity of this EPB41L2 antibody

Images

Immunohistochemical staining using EPB41L2 antibody (70R-4218)

EPB41L2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPB41L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using EPB41L2 antibody (70R-4218) | EPB41L2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using EPB41L2 antibody (70R-4218) | EPB41L2 antibody (70R-4218) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors