EPB42 antibody (70R-3611)

Rabbit polyclonal EPB42 antibody raised against the middle region of EPB42

Synonyms Polyclonal EPB42 antibody, Anti-EPB42 antibody, EPB-42, EPB-42 antibody, Erythrocyte Membrane Protein Band 4.2 antibody, EPB42, EPB 42 antibody, EPB 42
Specificity EPB42 antibody was raised against the middle region of EPB42
Cross Reactivity Human,Rat
Applications WB
Immunogen EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
Assay Information EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody

Images

Western Blot analysis using EPB42 antibody (70R-3611)

EPB42 antibody (70R-3611) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPB42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPB42 antibody (70R-3611) | EPB42 antibody (70R-3611) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors