EPB49 Blocking Peptide (33R-10351)

A synthetic peptide for use as a blocking control in assays to test for specificity of EPB49 antibody, catalog no. 70R-10354

Synonyms EPB49 control peptide, EPB49 antibody Blocking Peptide, Anti-EPB49 Blocking Peptide, erythrocyte membrane protein band 4.9, dematin Blocking Peptide, DMT Blocking Peptide, FLJ78462 Blocking Peptide, FLJ98848 Blocking Peptide, EPB49, EPB-49, EPB 49, EPB-49 Blocking Peptide, EPB 49 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDY
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors