Ephrin-B1 antibody (70R-6117)

Rabbit polyclonal Ephrin-B1 antibody raised against the middle region of EFNB1

Synonyms Polyclonal Ephrin-B1 antibody, Anti-Ephrin-B1 antibody, LERK2 antibody, MGC8782 antibody, CFNS antibody, Elk-L antibody, CFND antibody, EPLG2 antibody, EFNB1 antibody, EFL3 antibody
Specificity Ephrin-B1 antibody was raised against the middle region of EFNB1
Cross Reactivity Human, Mouse
Applications WB
Immunogen Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
Assay Information Ephrin-B1 Blocking Peptide, catalog no. 33R-8768, is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Images

Western Blot analysis using Ephrin-B1 antibody (70R-6117)

Ephrin-B1 antibody (70R-6117) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ephrin-B1 antibody (70R-6117) | Ephrin-B1 antibody (70R-6117) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors