EPO antibody (70R-6540)

Rabbit polyclonal EPO antibody raised against the middle region of EPO

Synonyms Polyclonal EPO antibody, Anti-EPO antibody, EP antibody, Erythropoietin antibody, MGC138142 antibody, Epoetin antibody, Erythropoietin-Alpha antibody, EPO-a antibody, EPO-alpha antibody, EP antibody
Specificity EPO antibody was raised against the middle region of EPO
Cross Reactivity Human
Applications WB
Immunogen EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
Assay Information EPO Blocking Peptide, catalog no. 33R-4315, is also available for use as a blocking control in assays to test for specificity of this EPO antibody

Images

Western Blot analysis using EPO antibody (70R-6540)

EPO antibody (70R-6540) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPO antibody (70R-6540) | EPO antibody (70R-6540) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors