EPOr antibody (70R-5994)

Rabbit polyclonal EPOr antibody raised against the N terminal of EPOR

Synonyms Polyclonal EPOr antibody, Anti-EPOr antibody, MGC138358 antibody, Erythropoietin Receptor antibody
Specificity EPOr antibody was raised against the N terminal of EPOR
Cross Reactivity Human,Dog
Applications WB
Immunogen EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL
Assay Information EPOr Blocking Peptide, catalog no. 33R-1978, is also available for use as a blocking control in assays to test for specificity of this EPOr antibody

Images

Western Blot analysis using EPOr antibody (70R-5994)

EPOr antibody (70R-5994) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPOR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EPOr antibody (70R-5994) | EPOr antibody (70R-5994) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors